FindThatThing
FindThatThing
ProductsCollectionsSearchCategoriesRequestAbout
›
›

FindThatThing

The product from that reel. Finally named. An independent directory for Indian shoppers.

Buy me a coffee

Browse

  • Home & Kitchen
  • Toys
  • Tech Gadgets
  • Beauty & Skin
  • Cooking Tools
  • Health & Wellness
  • Fashion & Style
  • Bikes & Automotive
  • All categories →

Info

  • About
  • Share a reel
  • Privacy
  • Terms
  • Contact
  • Notifications
  • Sitemap
  • Request a Product

As an Amazon Associate, FindThatThing earns from qualifying purchases at no extra cost to you. This doesn’t affect what you pay or which products we feature.

© 2026 FindThatThing

Built for Indian shoppers 🇮🇳

Home›Home & Kitchen›Ribbed Champagne Flutes Set of 6, 150 ml Clear Glass
Ribbed Champagne Flutes Set of 6, 150 ml Clear Glass
Homedrinkware

Ribbed Champagne Flutes Set of 6, 150 ml Clear Glass

If you're trying to make even a simple bottle of bubbly look more expensive, these are the glasses that do the job. The ribbed flute shape gives them that restaurant-table feel, while the tall narrow bowl helps sparkling drinks hold their fizz a bit longer and shows up perfect in photos too. You get a set of six clear 150 ml flutes, so they're just as useful for champagne and prosecco as they are for mocktails, festive sherbet, anniversary toasts, and New Year's hosting. The ribbed texture adds a nicer hand-feel than plain smooth glasses, and they look good on an open bar cart even when they're not in use. Works well for home dinners, house parties, wedding gifting, or the one your mom keeps asking about before guests come over. Under ₹1,500 for a full set of six makes sense if you want glassware that feels premium without going into hotel-supply pricing.

home-kitchendrinkwareglasswarechampagne-flutesbarwarehostinggiftingweddingset-of-6clear-glassunder-2000

Common questions

What is the Ribbed Champagne Flutes Set of 6, 150 ml Clear Glass?

If you're trying to make even a simple bottle of bubbly look more expensive, these are the glasses that do the job.

What is the Ribbed Champagne Flutes Set of 6, 150 ml Clear Glass also called?

It's also commonly called ribbed champagne flutes, ribbed champagne glasses, champagne flute set of 6 and ribbed flute glasses set.

Where can I buy the Ribbed Champagne Flutes Set of 6, 150 ml Clear Glass in India?

You can buy the Ribbed Champagne Flutes Set of 6, 150 ml Clear Glass in India on Amazon India.

You might also be looking for

3D Panda Ceramic Mug with Lid and Straw, 420 ml
Viral

mugs

3D Panda Ceramic Mug with Lid and Straw, 420 ml

Sliding Bottom Measuring Scoop Funnel for Protein Powder and Formula

measuring tools

Sliding Bottom Measuring Scoop Funnel for Protein Powder and Formula

Vacuum Compression Storage Bags with Hand Pump, Pack of 5 Medium Space Saving Bags for Clothes Blankets
Viral

Storage

Vacuum Compression Storage Bags with Hand Pump, Pack of 5 Medium Space Saving Bags for Clothes Blankets

Trending Right Now

Cigarette Box Bubble Blower Toy

Cigarette Box Bubble Blower Toy

Transparent Pink NFC Business Card with Visible Chip

Transparent Pink NFC Business Card with Visible Chip

Wind-Up Shin-chan Crawling Butt Wiggle Desk Toy

Wind-Up Shin-chan Crawling Butt Wiggle Desk Toy

Silicone Gear Shift Protector Cover for Motorcycle Shoes

Silicone Gear Shift Protector Cover for Motorcycle Shoes